PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 342aa    MW: 37888.2 Da    PI: 7.9989
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019262.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv ++++ G+g+W++++   g++R+ k+c++rw +yl
      Pbr019262.1 14 KGPWTPEEDIILVSYIQERGPGNWRAVPTNTGLHRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.63.8e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Pbr019262.1  67 RGNFTDKEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.064965IPR017930Myb domain
SuperFamilySSF466898.99E-3011108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.04E-91661No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.68166116IPR017930Myb domain
SMARTSM007171.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.5E-1467112IPR001005SANT/Myb domain
CDDcd001676.45E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVSYIQ ERGPGNWRAV PTNTGLHRCS KSCRLRWTNY  60
LRPGIRRGNF TDKEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLSKFQ  120
AEGGGAEGLH SKDQGLNSNS SSQPISRGQW ERRLQTDIHM ARQALRDALS PEKPLTLSSD  180
LNPTDGFSIS SPKKPTLDQS SSSTYASSTE NISRLLKGWM KNPPKKSASL TNLANNKTDY  240
QHYSSSEGTT SVANTANSGN VELSDTFESL FGFESSNSDL SPSMSPDSLF QGESKPDLIS  300
DQLPLSFLEK WLFDESAAPA ALGKDHFFSD MLSDHGNANF L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-25141164105C-Myb DNA-Binding Domain
1msf_C3e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376268.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-112MYB06_ANTMA; Myb-related protein 306
TrEMBLD9ZJ580.0D9ZJ58_MALDO; MYB domain class transcription factor
STRINGVIT_14s0108g00830.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-98myb domain protein 94